

Safety Report


Domain Information

Domain name

Title Tvspielfilm

Popularity Information


Reputation 70%

Listed In DMOZ Yes

Server Information

Ip Adress

Country Code DE

Country Germany

Region/State Bayern

City Munich

Latitude 48.15

Longitude 11.5833

About - Tvspielfilm seems to be a very popular site. is listed in DMoz, the most comprehensive human-reviewed directory of the web. Tvspielfilm IP Adress is and its server is located in Germany. You will find on this page usefull information about Safety.

Safety Report

Help us build the best Safety & Security Online Database !

Global Score: 100% (100/100) by :

IsTheWebSafe Global Score :

Site Quality :

Site Confidence :

Site Usefulness :

Global Safety / Security :

Adult Content / Child Safety :

Malware / Malicious Software :

Phishing / Fraud :

Popularity :

Server Location :

PoorNot rated yetExcellent
PoorNot rated yetExcellent
PoorNot rated yetExcellent

Recommend this site!

Server Location


Possible Domain Name Variations
tvbspielfilm.detbvspielfilm.det spielfilm.detv spielfilm.det
tvspielfilm.kdetvspielfilmk.detvspielfilmldetvspielfilm.ldetvspielfilm de
tvspielfilm. detvspielfilm .detvspielfilm,detvspielfilm.,detvspielfilm,.de

Related Sites

Domain nameTitleIPFrequentationReputation

Similar Popularity Sites

Domain nameTitleIPFrequentationReputation

Domain on same IP

Domain nameTitleIPFrequentationReputation

Write a review on FB


There is no Feedback yet. Be the first to post your feedback about!